Lineage for d1jigb_ (1jig B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2701728Species Bacillus anthracis, Dlp-2 [TaxId:1392] [74706] (1 PDB entry)
  8. 2701730Domain d1jigb_: 1jig B: [71686]
    complexed with fe

Details for d1jigb_

PDB Entry: 1jig (more details), 1.46 Å

PDB Description: Dlp-2 from Bacillus anthracis
PDB Compounds: (B:) Dlp-2

SCOPe Domain Sequences for d1jigb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jigb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-2 [TaxId: 1392]}
stktnvvevlnkqvanwnvlyvklhnyhwyvtgphfftlhekfeefyneagtyidelaer
ilalegkplatmkeylatssvnegtskesaeemvqtlvndysaliqelkegmevageagd
atsadmllaihttleqhvwmlsaflk

SCOPe Domain Coordinates for d1jigb_:

Click to download the PDB-style file with coordinates for d1jigb_.
(The format of our PDB-style files is described here.)

Timeline for d1jigb_: