Lineage for d1ji5d_ (1ji5 D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536008Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 536009Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 536010Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 536144Protein Dodecameric ferritin homolog [47250] (10 species)
  7. 536173Species Bacillus anthracis, Dlp-1 [TaxId:1392] [74705] (1 PDB entry)
  8. 536177Domain d1ji5d_: 1ji5 D: [71681]
    complexed with mpd, of3

Details for d1ji5d_

PDB Entry: 1ji5 (more details), 2.5 Å

PDB Description: Dlp-1 from bacillus anthracis

SCOP Domain Sequences for d1ji5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji5d_ a.25.1.1 (D:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-1}
qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai
ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts
dlllgiytelekhawmlrafln

SCOP Domain Coordinates for d1ji5d_:

Click to download the PDB-style file with coordinates for d1ji5d_.
(The format of our PDB-style files is described here.)

Timeline for d1ji5d_: