SCOP 1.69: Domain d1ji5c_: 1ji5 C:

Lineage for d1ji5c_ (1ji5 C:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (7 proteins)

6. Protein Dodecameric ferritin homolog [47250] (10 species)

7. Species Bacillus anthracis, Dlp-1 [TaxId:1392] [74705] (1 PDB entry)

8. Domain d1ji5c_: 1ji5 C: [71680]

Details for d1ji5c_

PDB Entry: 1ji5, 2.5 Å

PDB Description: Dlp-1 from bacillus anthracis

SCOP Domain Sequences for d1ji5c_:

Sequence; same for both SEQRES and ATOM records:

>d1ji5c_ a.25.1.1 (C:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-1}
qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai
ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts
dlllgiytelekhawmlrafln

Timeline for d1ji5c_:

• d1ji5c_ first appeared in SCOP 1.61
  
• d1ji5c_ appears in SCOP 1.67
  
• d1ji5c_ appears in SCOP 1.71
  
• d1ji5c_ appears in the current release, SCOPe 2.08