Lineage for d1ji5c_ (1ji5 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2701723Species Bacillus anthracis, Dlp-1 [TaxId:1392] [74705] (1 PDB entry)
  8. 2701726Domain d1ji5c_: 1ji5 C: [71680]
    complexed with fe, mpd

Details for d1ji5c_

PDB Entry: 1ji5 (more details), 2.5 Å

PDB Description: Dlp-1 from bacillus anthracis
PDB Compounds: (C:) Dlp-1

SCOPe Domain Sequences for d1ji5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ji5c_ a.25.1.1 (C:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-1 [TaxId: 1392]}
qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai
ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts
dlllgiytelekhawmlrafln

SCOPe Domain Coordinates for d1ji5c_:

Click to download the PDB-style file with coordinates for d1ji5c_.
(The format of our PDB-style files is described here.)

Timeline for d1ji5c_: