SCOPe 2.02: Domain d1ji5a_: 1ji5 A:

Lineage for d1ji5a_ (1ji5 A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (14 species)

7. Species Bacillus anthracis, Dlp-1 [TaxId:1392] [74705] (1 PDB entry)

8. Domain d1ji5a_: 1ji5 A: [71678]
   complexed with fe, mpd

Details for d1ji5a_

PDB Entry: 1ji5, 2.5 Å

PDB Description: Dlp-1 from bacillus anthracis

PDB Compounds: (A:) Dlp-1

SCOPe Domain Sequences for d1ji5a_:

Sequence; same for both SEQRES and ATOM records:

>d1ji5a_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-1 [TaxId: 1392]}
qvievlnkqvadwsvlftklhnfhwyvkgpqfftlhekfeelytesathideiaerilai
ggkpvatmkeyleissiqeaaygetaegmveaimkdyemmlvelkkgmeiaqnsddemts
dlllgiytelekhawmlrafln

Timeline for d1ji5a_:

• d1ji5a_ first appeared in SCOP 1.61
  
• d1ji5a_ appears in SCOPe 2.01
  
• d1ji5a_ appears in SCOPe 2.03
  
• d1ji5a_ appears in the current release, SCOPe 2.08