Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Maltogenic amylase [51031] (4 species) |
Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (8 PDB entries) |
Domain d1ji1a2: 1ji1 A:555-637 [71667] Other proteins in same PDB: d1ji1a1, d1ji1a3, d1ji1b1, d1ji1b3 complexed with ca |
PDB Entry: 1ji1 (more details), 1.6 Å
SCOPe Domain Sequences for d1ji1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ji1a2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh sytvqngmvtvavdghygavlaq
Timeline for d1ji1a2: