SCOPe 2.07: Domain d1jhwa3: 1jhw A:245-346

Lineage for d1jhwa3 (1jhw A:245-346)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)

6. Protein Macrophage capping protein Cap G [75511] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75512] (2 PDB entries)

8. Domain d1jhwa3: 1jhw A:245-346 [71664]
   complexed with eu3; mutant

Details for d1jhwa3

PDB Entry: 1jhw, 2.8 Å

PDB Description: Ca2+-binding Mimicry in the Crystal Structure of the Eu3+-Bound Mutant Human Macrophage Capping Protein Cap G

PDB Compounds: (A:) Macrophage capping protein

SCOPe Domain Sequences for d1jhwa3:

Sequence; same for both SEQRES and ATOM records:

>d1jhwa3 d.109.1.1 (A:245-346) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]}
aqaaalykvsdatgqmnltkvadsspfalellisddcfvldnglcgkiyiwkgrkaneke
rqaalqvaegfisrmqyapntqveilpqgrespifkqffkdw

Timeline for d1jhwa3:

• d1jhwa3 first appeared in SCOP 1.61
  
• d1jhwa3 appears in SCOPe 2.06
  
• d1jhwa3 appears in the current release, SCOPe 2.08