Lineage for d1jh3a_ (1jh3 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193185Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
  4. 193186Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
  5. 193212Family d.66.1.4: Tyrosyl-trna synthetase (TyrRS), C-terminal domain [75465] (1 protein)
  6. 193213Protein Tyrosyl-trna synthetase (TyrRS), C-terminal domain [75466] (1 species)
  7. 193214Species Bacillus stearothermophilus [TaxId:1422] [75467] (1 PDB entry)
  8. 193215Domain d1jh3a_: 1jh3 A: [71661]

Details for d1jh3a_

PDB Entry: 1jh3 (more details)

PDB Description: solution structure of tyrosyl-trna synthetase c-terminal domain.

SCOP Domain Sequences for d1jh3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jh3a_ d.66.1.4 (A:) Tyrosyl-trna synthetase (TyrRS), C-terminal domain {Bacillus stearothermophilus}
alfsgdianltaaeieqgfkdvpsfvheggdvplvellvsagispskrqarediqngaiy
vngerlqdvgailtaehrlegrftvirrgkkkyylirya

SCOP Domain Coordinates for d1jh3a_:

Click to download the PDB-style file with coordinates for d1jh3a_.
(The format of our PDB-style files is described here.)

Timeline for d1jh3a_: