Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.4: Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain [75465] (1 protein) there are additional N-terminal structures |
Protein Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain [75466] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [75467] (1 PDB entry) |
Domain d1jh3a_: 1jh3 A: [71661] |
PDB Entry: 1jh3 (more details)
SCOPe Domain Sequences for d1jh3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jh3a_ d.66.1.4 (A:) Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} alfsgdianltaaeieqgfkdvpsfvheggdvplvellvsagispskrqarediqngaiy vngerlqdvgailtaehrlegrftvirrgkkkyylirya
Timeline for d1jh3a_: