Lineage for d1jh3a_ (1jh3 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956861Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 2956862Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 2956952Family d.66.1.4: Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain [75465] (1 protein)
    there are additional N-terminal structures
  6. 2956953Protein Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain [75466] (2 species)
  7. 2956954Species Bacillus stearothermophilus [TaxId:1422] [75467] (1 PDB entry)
  8. 2956955Domain d1jh3a_: 1jh3 A: [71661]

Details for d1jh3a_

PDB Entry: 1jh3 (more details)

PDB Description: solution structure of tyrosyl-trna synthetase c-terminal domain.
PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d1jh3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jh3a_ d.66.1.4 (A:) Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
alfsgdianltaaeieqgfkdvpsfvheggdvplvellvsagispskrqarediqngaiy
vngerlqdvgailtaehrlegrftvirrgkkkyylirya

SCOPe Domain Coordinates for d1jh3a_:

Click to download the PDB-style file with coordinates for d1jh3a_.
(The format of our PDB-style files is described here.)

Timeline for d1jh3a_: