Lineage for d1jf6b2 (1jf6 B:503-585)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170927Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 170928Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 170929Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins)
  6. 171081Protein Maltogenic amylase [51031] (4 species)
  7. 171088Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (7 PDB entries)
  8. 171098Domain d1jf6b2: 1jf6 B:503-585 [71654]
    Other proteins in same PDB: d1jf6a1, d1jf6a3, d1jf6b1, d1jf6b3

Details for d1jf6b2

PDB Entry: 1jf6 (more details), 3.2 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase mutant f286y

SCOP Domain Sequences for d1jf6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jf6b2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOP Domain Coordinates for d1jf6b2:

Click to download the PDB-style file with coordinates for d1jf6b2.
(The format of our PDB-style files is described here.)

Timeline for d1jf6b2: