Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Maltogenic amylase, N-terminal domain N [49221] (4 species) precedes the catalytic (beta/alpha)8-barrel domain |
Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (12 PDB entries) |
Domain d1jf6b1: 1jf6 B:1-120 [71653] Other proteins in same PDB: d1jf6a2, d1jf6a3, d1jf6b2, d1jf6b3 complexed with ca; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1jf6 (more details), 3.2 Å
SCOPe Domain Sequences for d1jf6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jf6b1 b.1.18.2 (B:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
Timeline for d1jf6b1: