| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
| Protein Maltogenic amylase, N-terminal domain N [49221] (4 species) precedes the catalytic (beta/alpha)8-barrel domain |
| Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (12 PDB entries) |
| Domain d1jf5a1: 1jf5 A:1-120 [71644] Other proteins in same PDB: d1jf5a2, d1jf5a3, d1jf5b2, d1jf5b3 complexed with ca; mutant |
PDB Entry: 1jf5 (more details), 3.2 Å
SCOPe Domain Sequences for d1jf5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jf5a1 b.1.18.2 (A:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
Timeline for d1jf5a1: