SCOP 1.65: Domain d1jf4a_: 1jf4 A:

Lineage for d1jf4a_ (1jf4 A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)
   Heme-binding protein

6. Protein Glycera globin [46467] (1 species)

7. Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (8 PDB entries)

8. Domain d1jf4a_: 1jf4 A: [71643]
   component IV
   complexed with hem

Details for d1jf4a_

PDB Entry: 1jf4, 1.4 Å

PDB Description: Crystal Structure Of Component IV Glycera Dibranchiata Monomeric Hemoglobin

SCOP Domain Sequences for d1jf4a_:

Sequence; same for both SEQRES and ATOM records:

>d1jf4a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata)}
glsaaqrqvvastwkdiagsdngagvgkecftkflsahhdmaavfgfsgasdpgvadlga
kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
kmnaaakdawaaayadisgalisglqs

Timeline for d1jf4a_:

• d1jf4a_ first appeared in SCOP 1.61
  
• d1jf4a_ appears in SCOP 1.63
  
• d1jf4a_ appears in SCOP 1.67
  
• d1jf4a_ appears in the current release, SCOPe 2.08