Lineage for d1jf3a_ (1jf3 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 631774Protein Glycera globin [46467] (1 species)
  7. 631775Species Marine bloodworm (Glycera dibranchiata) [TaxId:6350] [46468] (8 PDB entries)
  8. 631780Domain d1jf3a_: 1jf3 A: [71642]
    component III
    complexed with hem

Details for d1jf3a_

PDB Entry: 1jf3 (more details), 1.4 Å

PDB Description: Crystal Structure Of Component III Glycera Dibranchiata Monomeric Hemoglobin
PDB Compounds: (A:) monomer hemoglobin component III

SCOP Domain Sequences for d1jf3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jf3a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}
glsaaqrqvvastwkdiagadngagvgkeclskfisahpemaavfgfsgasdpgvaelga
kvlaqigvavshlgdegkmvaemkavgvrhkgygnkhikaeyfeplgasllsamehrigg
kmnaaakdawaaaygdisgalisglqs

SCOP Domain Coordinates for d1jf3a_:

Click to download the PDB-style file with coordinates for d1jf3a_.
(The format of our PDB-style files is described here.)

Timeline for d1jf3a_: