SCOP 1.63: Domain d1je6a2: 1je6 A:0-180

Lineage for d1je6a2 (1je6 A:0-180)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC I homolog [54489] (3 species)
   gamma, delta T-cell ligand

7. Species Human (Homo sapiens), Micb [TaxId:9606] [75380] (1 PDB entry)

8. Domain d1je6a2: 1je6 A:0-180 [71639]
   Other proteins in same PDB: d1je6a1
   complexed with so4

Details for d1je6a2

PDB Entry: 1je6, 2.5 Å

PDB Description: structure of the mhc class i homolog micb

SCOP Domain Sequences for d1je6a2:

Sequence; same for both SEQRES and ATOM records:

>d1je6a2 d.19.1.1 (A:0-180) MHC I homolog {Human (Homo sapiens), Micb}
mephslrynlmvlsqdgsvqsgflaeghldgqpflrydrqkrrakpqgqwaedvlgaetw
dtetedltengqdlrrtlthikdqkgglhslqeirvceihedsstrgsrhfyyngelfls
qnletqestvpqssraqtlamnvtnfwkedamktkthyramqadclqklqrylksgvair
r

Timeline for d1je6a2:

• d1je6a2 first appeared in SCOP 1.61
  
• d1je6a2 appears in SCOP 1.65
  
• d1je6a2 appears in the current release, SCOPe 2.08