Lineage for d1je6a1 (1je6 A:181-274)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932638Protein Class I MHC homolog, alpha-3 domain [88610] (4 species)
    gamma, delta T-cell ligand
  7. 932642Species Human (Homo sapiens), Mic-b [TaxId:9606] [74826] (1 PDB entry)
  8. 932643Domain d1je6a1: 1je6 A:181-274 [71638]
    Other proteins in same PDB: d1je6a2
    complexed with so4

Details for d1je6a1

PDB Entry: 1je6 (more details), 2.5 Å

PDB Description: structure of the mhc class i homolog micb
PDB Compounds: (A:) MHC class I chain-related protein

SCOPe Domain Sequences for d1je6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1je6a1 b.1.1.2 (A:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-b [TaxId: 9606]}
tvppmvnvtcsevsegnitvtcrassfyprnitltwrqdgvslshntqqwgdvlpdgngt
yqtwvatrirqgeeqrftcymehsgnhgthpvps

SCOPe Domain Coordinates for d1je6a1:

Click to download the PDB-style file with coordinates for d1je6a1.
(The format of our PDB-style files is described here.)

Timeline for d1je6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1je6a2