SCOPe 2.04: Domain d1jcia_: 1jci A:

Lineage for d1jcia_ (1jci A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (170 PDB entries)
   Uniprot P00431

8. Domain d1jcia_: 1jci A: [71632]
   engineered calcium-binding loop
   complexed with hem, k

Details for d1jcia_

PDB Entry: 1jci, 1.9 Å

PDB Description: stabilization of the engineered cation-binding loop in cytochrome c peroxidase (ccp)

PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1jcia_:

Sequence; same for both SEQRES and ATOM records:

>d1jcia_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahtlgkt
hlknsgyegpwtanpnvfdnsfylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d1jcia_:

• d1jcia_ first appeared in SCOP 1.61
  
• d1jcia_ appears in SCOPe 2.03
  
• d1jcia_ appears in SCOPe 2.05
  
• d1jcia_ appears in the current release, SCOPe 2.08