Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein ClpB, AAA+ modules [75211] (2 species) ATPase subunit of ATP-dependent protease; similar domain organization to ClpA |
Species Escherichia coli [TaxId:562] [75212] (1 PDB entry) |
Domain d1jbka1: 1jbk A:159-351 [71631] Other proteins in same PDB: d1jbka2 N-terminal subdomain only complexed with mg |
PDB Entry: 1jbk (more details), 1.8 Å
SCOPe Domain Sequences for d1jbka1:
Sequence, based on SEQRES records: (download)
>d1jbka1 c.37.1.20 (A:159-351) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} qalkkytidlteraeqgkldpvigrdeeirrtiqvlqrrtknnpvligepgvgktaiveg laqriingevpeglkgrrvlaldmgalvagakyrgefeerlkgvlndlakqegnvilfid elhtmvgagkadgamdagnmlkpalargelhcvgattldeyrqyiekdaalerrfqkvfv aepsvedtiailr
>d1jbka1 c.37.1.20 (A:159-351) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} qalkkytidlteraeqgkldpvigrdeeirrtiqvlqrrtknnpvligepgvgktaiveg laqriingevpeglkgrrvlaldmgalvagakyrgefeerlkgvlndlakqegnvilfid elhtmvgamdagnmlkpalargelhcvgattldeyrqyiekdaalerrfqkvfvaepsve dtiailr
Timeline for d1jbka1: