Lineage for d1j99a_ (1j99 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313455Family c.37.1.5: PAPS sulfotransferase [52575] (5 proteins)
    similar to the nucleotide/nucleoside kinases but transfer sulphate group
  6. 313475Protein Hydroxysteroid sulfotransferase [52578] (1 species)
  7. 313476Species Human (Homo sapiens) [TaxId:9606] [52579] (2 PDB entries)
  8. 313477Domain d1j99a_: 1j99 A: [71618]
    complexed with and, hgi, iod

Details for d1j99a_

PDB Entry: 1j99 (more details), 1.99 Å

PDB Description: crystal structure of human dehydroepiandrosterone sulfotransferase in complex with substrate

SCOP Domain Sequences for d1j99a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j99a_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase {Human (Homo sapiens)}
sddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskg
dakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmr
nprdvlvsgyffwknmkflkkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfll
lsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvd
ktqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe

SCOP Domain Coordinates for d1j99a_:

Click to download the PDB-style file with coordinates for d1j99a_.
(The format of our PDB-style files is described here.)

Timeline for d1j99a_: