![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.5: PAPS sulfotransferase [52575] (5 proteins) similar to the nucleotide/nucleoside kinases but transfer sulphate group |
![]() | Protein Hydroxysteroid sulfotransferase [52578] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52579] (2 PDB entries) |
![]() | Domain d1j99a_: 1j99 A: [71618] complexed with and, hgi, iod |
PDB Entry: 1j99 (more details), 1.99 Å
SCOP Domain Sequences for d1j99a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j99a_ c.37.1.5 (A:) Hydroxysteroid sulfotransferase {Human (Homo sapiens)} sddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskg dakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmr nprdvlvsgyffwknmkflkkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfll lsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvd ktqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe
Timeline for d1j99a_: