Lineage for d1j8hd1 (1j8h D:1-117)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288452Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 288453Species Human (Homo sapiens), alpha-chain [TaxId:9606] [48935] (10 PDB entries)
  8. 288458Domain d1j8hd1: 1j8h D:1-117 [71606]
    Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd2, d1j8he2
    complexed with nag; mutant

Details for d1j8hd1

PDB Entry: 1j8h (more details), 2.4 Å

PDB Description: Crystal Structure of a Complex of a Human alpha/beta-T cell Receptor, Influenza HA Antigen Peptide, and MHC Class II Molecule, HLA-DR4

SCOP Domain Sequences for d1j8hd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
qsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgin
gfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiipn

SCOP Domain Coordinates for d1j8hd1:

Click to download the PDB-style file with coordinates for d1j8hd1.
(The format of our PDB-style files is described here.)

Timeline for d1j8hd1: