SCOPe 2.01: Domain d1j8hb2: 1j8h B:3-92

Lineage for d1j8hb2 (1j8h B:3-92)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (12 PDB entries)

8. Domain d1j8hb2: 1j8h B:3-92 [71605]
   Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hd1, d1j8hd2, d1j8he1, d1j8he2
   complexed with nag, ndg

Details for d1j8hb2

PDB Entry: 1j8h, 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4

PDB Compounds: (B:) hla class II histocompatibility antigen, dr-4 beta chain

SCOPe Domain Sequences for d1j8hb2:

Sequence; same for both SEQRES and ATOM records:

>d1j8hb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
trprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeywn
sqkdlleqkraavdtycrhnygvgesftvq

Timeline for d1j8hb2:

• d1j8hb2 first appeared in SCOP 1.61
  
• d1j8hb2 appears in SCOP 1.75
  
• d1j8hb2 appears in SCOPe 2.02
  
• d1j8hb2 appears in the current release, SCOPe 2.08