SCOP 1.67: Domain d1j8hb2: 1j8h B:3-92

Lineage for d1j8hb2 (1j8h B:3-92)

Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)
Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (5 PDB entries)
Domain d1j8hb2: 1j8h B:3-92 [71605]
Other proteins in same PDB: d1j8ha1, d1j8ha2, d1j8hb1, d1j8hd1, d1j8hd2, d1j8he1, d1j8he2
complexed with nag; mutant

Details for d1j8hb2

PDB Entry: 1j8h (more details), 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4

SCOP Domain Sequences for d1j8hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8hb2 d.19.1.1 (B:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4}
trprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeywn
sqkdlleqkraavdtycrhnygvgesftvq

SCOP Domain Coordinates for d1j8hb2:

Click to download the PDB-style file with coordinates for d1j8hb2.
(The format of our PDB-style files is described here.)

Timeline for d1j8hb2: