SCOP 1.63: Domain d1j8hb2: 1j8h B:3-92

Lineage for d1j8hb2 (1j8h B:3-92)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (12 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [54463] (5 PDB entries)

8. Domain d1j8hb2: 1j8h B:3-92 [71605]
   Other proteins in same PDB: d1j8ha1, d1j8hb1, d1j8hd1, d1j8hd2, d1j8he1, d1j8he2
   complexed with nag; mutant

Details for d1j8hb2

PDB Entry: 1j8h, 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4

SCOP Domain Sequences for d1j8hb2:

Sequence; same for both SEQRES and ATOM records:

>d1j8hb2 d.19.1.1 (B:3-92) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR4}
trprfleqvkhechffngtervrfldryfyhqeeyvrfdsdvgeyravtelgrpdaeywn
sqkdlleqkraavdtycrhnygvgesftvq

Timeline for d1j8hb2:

• d1j8hb2 first appeared in SCOP 1.61
  
• d1j8hb2 appears in SCOP 1.65
  
• d1j8hb2 appears in the current release, SCOPe 2.08