SCOP 1.67: Domain d1j8ha1: 1j8h A:82-181

Lineage for d1j8ha1 (1j8h A:82-181)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (25 PDB entries)
   probably orthologous to the mouse I-E group

8. Domain d1j8ha1: 1j8h A:82-181 [71602]
   Other proteins in same PDB: d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd1, d1j8hd2, d1j8he1, d1j8he2
   complexed with nag; mutant

Details for d1j8ha1

PDB Entry: 1j8h, 2.4 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr4

SCOP Domain Sequences for d1j8ha1:

Sequence; same for both SEQRES and ATOM records:

>d1j8ha1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d1j8ha1:

• d1j8ha1 first appeared in SCOP 1.61
  
• d1j8ha1 appears in SCOP 1.65
  
• d1j8ha1 appears in SCOP 1.69
  
• d1j8ha1 appears in the current release, SCOPe 2.08