| Class b: All beta proteins [48724] (141 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
| Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (25 PDB entries) probably orthologous to the mouse I-E group |
| Domain d1j8ha1: 1j8h A:82-181 [71602] Other proteins in same PDB: d1j8ha2, d1j8hb1, d1j8hb2, d1j8hd1, d1j8hd2, d1j8he1, d1j8he2 complexed with nag; mutant |
PDB Entry: 1j8h (more details), 2.4 Å
SCOP Domain Sequences for d1j8ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j8ha1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd
Timeline for d1j8ha1: