SCOPe 2.08: Domain d1j6rb1: 1j6r B:3-197

Lineage for d1j6rb1 (1j6r B:3-197)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.173: Methionine synthase activation domain-like [56506] (1 superfamily)
   unusual fold; core: beta-alpha(2)-beta(2)-alpha(2)-beta-alpha-beta; antiparallel beta-sheet: order 12354

4. Superfamily d.173.1: Methionine synthase activation domain-like [56507] (3 families)

5. Family d.173.1.2: Hypothetical protein TM0269 [75590] (1 protein)

6. Protein Hypothetical protein TM0269 [75591] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [75592] (1 PDB entry)

8. Domain d1j6rb1: 1j6r B:3-197 [71599]
   Other proteins in same PDB: d1j6ra2, d1j6rb2
   structural genomics

Details for d1j6rb1

PDB Entry: 1j6r, 2.3 Å

PDB Description: crystal structure of activation (adomet binding) domain of methionine synthase (tm0269) from thermotoga maritima at 2.2 a resolution

PDB Compounds: (B:) methionine synthase

SCOPe Domain Sequences for d1j6rb1:

Sequence; same for both SEQRES and ATOM records:

>d1j6rb1 d.173.1.2 (B:3-197) Hypothetical protein TM0269 {Thermotoga maritima [TaxId: 2336]}
mpkveiapseikipdnvlkaklgfggaeeipeefrktvnrayeelldaakpvvlwrdfev
dgslsfddmrltgelatkhlsgskiitvflatlgkkvdekieeyfrkgedllaffidgia
semveyalrkvdaelrmkrsnlegsfrispgygdlplslnkkiaeifkeevdvnviedsy
vlvprktitafvgwr

Timeline for d1j6rb1:

• d1j6rb1 first appeared in SCOP 1.61, called d1j6rb_
  
• d1j6rb1 appears in SCOPe 2.07