Lineage for d1j6nc_ (1j6n C:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 320763Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 320764Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 320765Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (6 proteins)
  6. 320829Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (2 species)
  7. 320839Species Thermotoga maritima [TaxId:243274] [75312] (1 PDB entry)
    TM0665
  8. 320842Domain d1j6nc_: 1j6n C: [71596]

Details for d1j6nc_

PDB Entry: 1j6n (more details), 1.8 Å

PDB Description: Crystal structure of Cysteine synthase (TM0665) from Thermotoga maritima at 1.8 A resolution

SCOP Domain Sequences for d1j6nc_:

Sequence, based on SEQRES records: (download)

>d1j6nc_ c.79.1.1 (C:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima}
hmmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaekrgllkngivep
tsgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaelvltpgelgmkgavekal
eisretgahmlnqfenpynvyshqfttgpeilkqmdyqidafvagvgtggtisgvgrvlk
gffgngvkivavepakspvlsggqpgkhaiqgigagfvpkildrsvidevitvedeeaye
marylakkegllvgissganvaaalkvaqklgpdarvvtvapdhaerylsi

Sequence, based on observed residues (ATOM records): (download)

>d1j6nc_ c.79.1.1 (C:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima}
hmmerligstpivrldsidsriflkleknnpggsvkdrpalfmildaekrgllkngivep
tsgnmgiaiamigakrghrviltmpetmsverrkvlkmlgaeahmlnqfenpynvyshqf
ttgpeilkqmdyqidafvagvgtggtisgvgrvlkgffgngvkivavepakspvlsggqp
gkhaiqgigagfvpkildrsvidevitvedeeayemarylakkegllvgissganvaaal
kvaqklgpdarvvtvapdhaerylsi

SCOP Domain Coordinates for d1j6nc_:

Click to download the PDB-style file with coordinates for d1j6nc_.
(The format of our PDB-style files is described here.)

Timeline for d1j6nc_: