Lineage for d1j5ra_ (1j5r A:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 267153Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 267154Superfamily e.22.1: Dehydroquinate synthase-like [56796] (2 families) (S)
  5. 267160Family e.22.1.2: Glycerol dehydrogenase-like [69892] (2 proteins)
  6. 267161Protein Alcohol dehydrogenase TM0920 [75612] (1 species)
  7. 267162Species Thermotoga maritima [TaxId:243274] [75613] (1 PDB entry)
  8. 267163Domain d1j5ra_: 1j5r A: [71578]

Details for d1j5ra_

PDB Entry: 1j5r (more details), 1.4 Å

PDB Description: Crystal structure of alcohol dehydrogenase (TM0920) from Thermotoga maritima at 1.4 A resolution

SCOP Domain Sequences for d1j5ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5ra_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima}
mwefymptdvffgekilekrgniidllgkralvvtgkssskkngslddlkklldeteisy
eifdeveenpsfdnvmkaveryrndsfdfvvglgggspmdfakavavllkekdlsvedly
drekvkhwlpvveipttagtgsevtpysiltdpegnkrgctlmfpvyafldprytysmsd
eltlstgvdalshavegylsrkstppsdalaieamkiihrnlpkaiegnrearkkmfvas
clagmviaqtgttlahalgyplttekgikhgkatgmvlpfvmevmkeeipekvdtvnhif
ggsllkflkelglyekvavsseelekwvekgsrakhlkntpgtftpekirniyrealgv

SCOP Domain Coordinates for d1j5ra_:

Click to download the PDB-style file with coordinates for d1j5ra_.
(The format of our PDB-style files is described here.)

Timeline for d1j5ra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1j5rb_