Lineage for d1j5ol1 (1j5o L:1-107)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157862Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (3 PDB entries)
  8. 157868Domain d1j5ol1: 1j5o L:1-107 [71573]
    Other proteins in same PDB: d1j5oa1, d1j5oa2, d1j5ob1, d1j5oh2, d1j5ol2

Details for d1j5ol1

PDB Entry: 1j5o (more details), 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer

SCOP Domain Sequences for d1j5ol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5ol1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
afsgsgsgtdysltisnlepedfatyycqqyskfpwtfgggtkleik

SCOP Domain Coordinates for d1j5ol1:

Click to download the PDB-style file with coordinates for d1j5ol1.
(The format of our PDB-style files is described here.)

Timeline for d1j5ol1: