SCOP 1.63: Domain d1j5oh2: 1j5o H:124-220

Lineage for d1j5oh2 (1j5o H:124-220)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab 28 against HIV-1 RT (mouse), kappa L chain [49068] (5 PDB entries)

8. Domain d1j5oh2: 1j5o H:124-220 [71572]
   Other proteins in same PDB: d1j5oa1, d1j5oa2, d1j5ob_, d1j5oh1, d1j5ol1
   mutant

Details for d1j5oh2

PDB Entry: 1j5o, 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer

SCOP Domain Sequences for d1j5oh2:

Sequence; same for both SEQRES and ATOM records:

>d1j5oh2 b.1.1.2 (H:124-220) Immunoglobulin (constant domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
aattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkki

Timeline for d1j5oh2:

• d1j5oh2 first appeared in SCOP 1.61
  
• d1j5oh2 appears in SCOP 1.65
  
• d1j5oh2 appears in the current release, SCOPe 2.08