SCOPe 2.07: Domain d1j5ob_: 1j5o B:

Lineage for d1j5ob_ (1j5o B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein HIV-1 reverse transcriptase [56689] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (204 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1j5ob_: 1j5o B: [71570]
   Other proteins in same PDB: d1j5oa1, d1j5oh1, d1j5oh2, d1j5ol1, d1j5ol2
   protein/DNA complex; mutant

Details for d1j5ob_

PDB Entry: 1j5o, 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer

PDB Compounds: (B:) reverse transcriptase

SCOPe Domain Sequences for d1j5ob_:

Sequence; same for both SEQRES and ATOM records:

>d1j5ob_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqyiddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyqle

Timeline for d1j5ob_:

• d1j5ob_ first appeared in SCOP 1.61, called d1j5ob1
  
• d1j5ob_ appears in SCOPe 2.06
  
• d1j5ob_ appears in the current release, SCOPe 2.08