Lineage for d1j5oa2 (1j5o A:1-429)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451898Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1451899Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1452158Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 1452159Protein HIV-1 reverse transcriptase [56689] (3 species)
  7. 1452191Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (138 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 1452459Domain d1j5oa2: 1j5o A:1-429 [71569]
    Other proteins in same PDB: d1j5oa1, d1j5oh1, d1j5oh2, d1j5ol1, d1j5ol2
    protein/DNA complex; mutant

Details for d1j5oa2

PDB Entry: 1j5o (more details), 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer
PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d1j5oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5oa2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqyiddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d1j5oa2:

Click to download the PDB-style file with coordinates for d1j5oa2.
(The format of our PDB-style files is described here.)

Timeline for d1j5oa2: