Lineage for d1j5oa2 (1j5o A:1-429)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266689Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 266690Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 266747Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 266748Protein HIV-1 reverse transcriptase [56689] (2 species)
  7. 266749Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (63 PDB entries)
  8. 266873Domain d1j5oa2: 1j5o A:1-429 [71569]
    Other proteins in same PDB: d1j5oa1, d1j5oh1, d1j5oh2, d1j5ol1, d1j5ol2
    mutant

Details for d1j5oa2

PDB Entry: 1j5o (more details), 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer

SCOP Domain Sequences for d1j5oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5oa2 e.8.1.2 (A:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqyiddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOP Domain Coordinates for d1j5oa2:

Click to download the PDB-style file with coordinates for d1j5oa2.
(The format of our PDB-style files is described here.)

Timeline for d1j5oa2: