Lineage for d1j5oa1 (1j5o A:430-558)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 246267Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
    consists of one domain of this fold
  5. 246268Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 246278Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 246279Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (65 PDB entries)
  8. 246345Domain d1j5oa1: 1j5o A:430-558 [71568]
    Other proteins in same PDB: d1j5oa2, d1j5ob_, d1j5oh1, d1j5oh2, d1j5ol1, d1j5ol2
    mutant

Details for d1j5oa1

PDB Entry: 1j5o (more details), 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer

SCOP Domain Sequences for d1j5oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5oa1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

SCOP Domain Coordinates for d1j5oa1:

Click to download the PDB-style file with coordinates for d1j5oa1.
(The format of our PDB-style files is described here.)

Timeline for d1j5oa1: