SCOP 1.61: Domain d1j5oa1: 1j5o A:430-558

Lineage for d1j5oa1 (1j5o A:430-558)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (57 PDB entries)

8. Domain d1j5oa1: 1j5o A:430-558 [71568]
   Other proteins in same PDB: d1j5oa2, d1j5ob1, d1j5oh1, d1j5oh2, d1j5ol1, d1j5ol2

Details for d1j5oa1

PDB Entry: 1j5o, 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer

SCOP Domain Sequences for d1j5oa1:

Sequence; same for both SEQRES and ATOM records:

>d1j5oa1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

Timeline for d1j5oa1:

• d1j5oa1 is new in SCOP 1.61
  
• d1j5oa1 appears in SCOP 1.63
  
• d1j5oa1 appears in the current release, SCOPe 2.07