SCOPe 2.07: Domain d1j5es_: 1j5e S:

Lineage for d1j5es_ (1j5e S:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
   alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)
   automatically mapped to Pfam PF00203

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
   Uniprot P80381

8. Domain d1j5es_: 1j5e S: [71562]
   Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5et_, d1j5ev_
   complexed with unx, zn

Details for d1j5es_

PDB Entry: 1j5e, 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d1j5es_:

Sequence; same for both SEQRES and ATOM records:

>d1j5es_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

Timeline for d1j5es_:

• d1j5es_ first appeared in SCOP 1.61
  
• d1j5es_ appears in SCOPe 2.06
  
• d1j5es_ appears in the current release, SCOPe 2.08