Lineage for d1j5es_ (1j5e S:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190914Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
  4. 190915Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 190916Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 190917Protein Ribosomal protein S19 [54572] (1 species)
  7. 190918Species Thermus thermophilus [TaxId:274] [54573] (12 PDB entries)
  8. 190921Domain d1j5es_: 1j5e S: [71562]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5et_, d1j5ev_

Details for d1j5es_

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

SCOP Domain Sequences for d1j5es_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5es_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1j5es_:

Click to download the PDB-style file with coordinates for d1j5es_.
(The format of our PDB-style files is described here.)

Timeline for d1j5es_: