SCOPe 2.06: Domain d1j5er_: 1j5e R:

Lineage for d1j5er_ (1j5e R:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
   Uniprot P80382

8. Domain d1j5er_: 1j5e R: [71561]
   Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5es_, d1j5et_, d1j5ev_
   complexed with unx, zn

Details for d1j5er_

PDB Entry: 1j5e, 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d1j5er_:

Sequence; same for both SEQRES and ATOM records:

>d1j5er_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

Timeline for d1j5er_:

• d1j5er_ first appeared in SCOP 1.61
  
• d1j5er_ appears in SCOPe 2.05
  
• d1j5er_ appears in SCOPe 2.07
  
• d1j5er_ appears in the current release, SCOPe 2.08