Lineage for d1j5er_ (1j5e R:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) 
Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) 
Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) Protein Ribosomal protein S18 [46913] (1 species) Species Thermus thermophilus [TaxId:274] [46914] (11 PDB entries) 
Domain d1j5er_: 1j5e R: [71561]
Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5es_, d1j5et_, d1j5ev_
Details for d1j5er_
PDB Entry: 1j5e (more details), 3.05 Å
PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit
SCOP Domain Sequences for d1j5er_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5er_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk
SCOP Domain Coordinates for d1j5er_:
Click to download the PDB-style file with coordinates for d1j5er_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j5er_:
- d1j5er_ is new in SCOP 1.61
- d1j5er_ appears in SCOP 1.63
- d1j5er_ appears in the current release, SCOPe 2.08
View in 3D
