| Class g: Small proteins [56992] (66 folds) |
| Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (9 families) ![]() |
| Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein) |
| Protein Ribosomal protein S14 [57753] (1 species) |
| Species Thermus thermophilus [TaxId:274] [57754] (14 PDB entries) |
| Domain d1j5en_: 1j5e N: [71557] Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_ complexed with unx, zn |
PDB Entry: 1j5e (more details), 3.05 Å
SCOP Domain Sequences for d1j5en_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5en_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
Timeline for d1j5en_: