Lineage for d1j5em_ (1j5e M:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies) 
Superfamily a.5.5: Ribosomal protein S13 [46946] (1 family) 
Family a.5.5.1: Ribosomal protein S13 [46947] (1 protein) Protein Ribosomal protein S13 [46948] (1 species) Species Thermus thermophilus [TaxId:274] [46949] (10 PDB entries) 
Domain d1j5em_: 1j5e M: [71556]
Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
Details for d1j5em_
PDB Entry: 1j5e (more details), 3.05 Å
PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit
SCOP Domain Sequences for d1j5em_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5em_ a.5.5.1 (M:) Ribosomal protein S13 {Thermus thermophilus}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk
SCOP Domain Coordinates for d1j5em_:
Click to download the PDB-style file with coordinates for d1j5em_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j5em_:
- d1j5em_ is new in SCOP 1.61
- d1j5em_ appears in SCOP 1.63
- d1j5em_ appears in the current release, SCOPe 2.08
View in 3D
