SCOPe 2.07: Domain d1j5ek_: 1j5e K:

Lineage for d1j5ek_ (1j5e K:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein S11 [53141] (2 species)

7. Species Thermus thermophilus [TaxId:274] [53142] (46 PDB entries)
   Uniprot P80376

8. Domain d1j5ek_: 1j5e K: [71554]
   Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
   complexed with unx, zn

Details for d1j5ek_

PDB Entry: 1j5e, 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d1j5ek_:

Sequence; same for both SEQRES and ATOM records:

>d1j5ek_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas

Timeline for d1j5ek_:

• d1j5ek_ first appeared in SCOP 1.61
  
• d1j5ek_ appears in SCOPe 2.06
  
• d1j5ek_ appears in the current release, SCOPe 2.08