Class a: All alpha proteins [46456] (286 folds) |
Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) |
Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
Protein Ribosomal protein S7 [47975] (4 species) |
Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries) Uniprot P17291 |
Domain d1j5eg_: 1j5e G: [71550] Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_ complexed with unx, zn |
PDB Entry: 1j5e (more details), 3.05 Å
SCOPe Domain Sequences for d1j5eg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5eg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]} arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria helmdaaegkggavkkkedvermaeanrayahyrw
Timeline for d1j5eg_: