Lineage for d1j5eg_ (1j5e G:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740240Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1740241Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1740242Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1740243Protein Ribosomal protein S7 [47975] (4 species)
  7. 1740273Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1740279Domain d1j5eg_: 1j5e G: [71550]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
    complexed with unx, zn

Details for d1j5eg_

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1j5eg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5eg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d1j5eg_:

Click to download the PDB-style file with coordinates for d1j5eg_.
(The format of our PDB-style files is described here.)

Timeline for d1j5eg_: