SCOPe 2.07: Domain d1j5ef_: 1j5e F:

Lineage for d1j5ef_ (1j5e F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family)

5. Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)

6. Protein Ribosomal protein S6 [54997] (4 species)

7. Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
   Uniprot P23370

8. Domain d1j5ef_: 1j5e F: [71549]
   Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
   complexed with unx, zn

Details for d1j5ef_

PDB Entry: 1j5e, 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1j5ef_:

Sequence; same for both SEQRES and ATOM records:

>d1j5ef_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

Timeline for d1j5ef_:

• d1j5ef_ first appeared in SCOP 1.61
  
• d1j5ef_ appears in SCOPe 2.06
  
• d1j5ef_ appears in the current release, SCOPe 2.08