SCOP 1.71: Domain d1j5ee2: 1j5e E:5-73

Lineage for d1j5ee2 (1j5e E:5-73)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.50: dsRBD-like [54767] (4 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (2 species)
   lacks the N-terminal helix

7. Species Thermus thermophilus [TaxId:274] [54781] (18 PDB entries)

8. Domain d1j5ee2: 1j5e E:5-73 [71548]
   Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
   complexed with unx, zn

Details for d1j5ee2

PDB Entry: 1j5e, 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit

SCOP Domain Sequences for d1j5ee2:

Sequence; same for both SEQRES and ATOM records:

>d1j5ee2 d.50.1.2 (E:5-73) Ribosomal S5 protein, N-terminal domain {Thermus thermophilus}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqn

Timeline for d1j5ee2:

• d1j5ee2 first appeared in SCOP 1.61
  
• d1j5ee2 appears in SCOP 1.69
  
• d1j5ee2 appears in SCOP 1.73
  
• d1j5ee2 appears in the current release, SCOPe 2.08