Lineage for d1j5ec2 (1j5e C:107-207)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722852Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 722853Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 722854Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 722855Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 722856Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
  8. 722857Domain d1j5ec2: 1j5e C:107-207 [71545]
    Other proteins in same PDB: d1j5eb_, d1j5ec1, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_
    complexed with unx, zn

Details for d1j5ec2

PDB Entry: 1j5e (more details), 3.05 Å

PDB Description: Structure of the Thermus thermophilus 30S Ribosomal Subunit
PDB Compounds: (C:) 30S ribosomal protein S3

SCOP Domain Sequences for d1j5ec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5ec2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1j5ec2:

Click to download the PDB-style file with coordinates for d1j5ec2.
(The format of our PDB-style files is described here.)

Timeline for d1j5ec2: