![]() | Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
![]() | Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
![]() | Protein Ribosomal protein S2 [52315] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52316] (14 PDB entries) |
![]() | Domain d1j5eb_: 1j5e B: [71543] Other proteins in same PDB: d1j5ec1, d1j5ec2, d1j5ed_, d1j5ee1, d1j5ee2, d1j5ef_, d1j5eg_, d1j5eh_, d1j5ei_, d1j5ej_, d1j5ek_, d1j5el_, d1j5em_, d1j5en_, d1j5eo_, d1j5ep_, d1j5eq_, d1j5er_, d1j5es_, d1j5et_, d1j5ev_ complexed with unx, zn |
PDB Entry: 1j5e (more details), 3.05 Å
SCOP Domain Sequences for d1j5eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j5eb_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus} vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
Timeline for d1j5eb_: