SCOPe 2.03: Domain d1j59a2: 1j59 A:9-137

Lineage for d1j59a2 (1j59 A:9-137)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)

7. Species Escherichia coli [TaxId:562] [51212] (28 PDB entries)

8. Domain d1j59a2: 1j59 A:9-137 [71533]
   Other proteins in same PDB: d1j59a1, d1j59b1
   protein/DNA complex; complexed with cmp

Details for d1j59a2

PDB Entry: 1j59, 2.5 Å

PDB Description: catabolite gene activator protein (cap)/dna complex + adenosine-3',5'- cyclic-monophosphate

PDB Compounds: (A:) catabolite gene activator protein (cap)

SCOPe Domain Sequences for d1j59a2:

Sequence; same for both SEQRES and ATOM records:

>d1j59a2 b.82.3.2 (A:9-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd
figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts
ekvgnlafl

Timeline for d1j59a2:

• d1j59a2 first appeared in SCOP 1.61
  
• d1j59a2 appears in SCOPe 2.02
  
• d1j59a2 appears in SCOPe 2.04
  
• d1j59a2 appears in the current release, SCOPe 2.08