SCOP 1.65: Domain d1j4na_: 1j4n A:

Lineage for d1j4na_ (1j4n A:)

1. Root: SCOP 1.65

2. Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)

3. Fold f.19: Aquaporin-like [81339] (1 superfamily)
   core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices

4. Superfamily f.19.1: Aquaporin-like [81338] (1 family)

5. Family f.19.1.1: Aquaporin-like [56895] (2 proteins)
   duplication: consist of two similar structural parts

6. Protein Aquaporin-1 [56896] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [75642] (1 PDB entry)

8. Domain d1j4na_: 1j4n A: [71510]
   complexed with bng

Details for d1j4na_

PDB Entry: 1j4n, 2.2 Å

PDB Description: crystal structure of the aqp1 water channel

SCOP Domain Sequences for d1j4na_:

Sequence; same for both SEQRES and ATOM records:

>d1j4na_ f.19.1.1 (A:) Aquaporin-1 {Cow (Bos taurus)}
masefkkklfwravvaeflamilfifisigsalgfhypiksnqttgavqdnvkvslafgl
siatlaqsvghisgahlnpavtlglllscqisvlraimyiiaqcvgaivatailsgitss
lpdnslglnalapgvnsgqglgieiigtlqlvlcvlattdrrrrdlggsgplaigfsval
ghllaidytgcginparsfgssvithnfqdhwifwvgpfigaalavliydfilaprssdl
tdrvkvwts

Timeline for d1j4na_:

• d1j4na_ first appeared in SCOP 1.61
  
• d1j4na_ appears in SCOP 1.63
  
• d1j4na_ appears in SCOP 1.67
  
• d1j4na_ appears in the current release, SCOPe 2.08