Lineage for d1j4na_ (1j4n A:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 267942Fold f.19: Aquaporin-like [81339] (1 superfamily)
    core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices
  4. 267943Superfamily f.19.1: Aquaporin-like [81338] (1 family) (S)
  5. 267944Family f.19.1.1: Aquaporin-like [56895] (2 proteins)
    duplication: consist of two similar structural parts
  6. 267945Protein Aquaporin-1 [56896] (2 species)
  7. 267946Species Cow (Bos taurus) [TaxId:9913] [75642] (1 PDB entry)
  8. 267947Domain d1j4na_: 1j4n A: [71510]
    complexed with bng

Details for d1j4na_

PDB Entry: 1j4n (more details), 2.2 Å

PDB Description: crystal structure of the aqp1 water channel

SCOP Domain Sequences for d1j4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4na_ f.19.1.1 (A:) Aquaporin-1 {Cow (Bos taurus)}
masefkkklfwravvaeflamilfifisigsalgfhypiksnqttgavqdnvkvslafgl
siatlaqsvghisgahlnpavtlglllscqisvlraimyiiaqcvgaivatailsgitss
lpdnslglnalapgvnsgqglgieiigtlqlvlcvlattdrrrrdlggsgplaigfsval
ghllaidytgcginparsfgssvithnfqdhwifwvgpfigaalavliydfilaprssdl
tdrvkvwts

SCOP Domain Coordinates for d1j4na_:

Click to download the PDB-style file with coordinates for d1j4na_.
(The format of our PDB-style files is described here.)

Timeline for d1j4na_: