Lineage for d1j4na_ (1j4n A:)
- Root: SCOP 1.61
Class f: Membrane and cell surface proteins and peptides [56835] (12 folds) 
Fold f.2: Membrane all-alpha [56868] (1 superfamily) Superfamily f.2.1: Membrane all-alpha [56869] (13 families) 
Family f.2.1.5: Aquaporin-like [56895] (2 proteins) 
Protein Aquaporin-1 [56896] (2 species) Species Cow (Bos taurus) [TaxId:9913] [75642] (1 PDB entry) 
Domain d1j4na_: 1j4n A: [71510]
Details for d1j4na_
PDB Entry: 1j4n (more details), 2.2 Å
PDB Description: crystal structure of the aqp1 water channel
SCOP Domain Sequences for d1j4na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j4na_ f.2.1.5 (A:) Aquaporin-1 {Cow (Bos taurus)}
masefkkklfwravvaeflamilfifisigsalgfhypiksnqttgavqdnvkvslafgl
siatlaqsvghisgahlnpavtlglllscqisvlraimyiiaqcvgaivatailsgitss
lpdnslglnalapgvnsgqglgieiigtlqlvlcvlattdrrrrdlggsgplaigfsval
ghllaidytgcginparsfgssvithnfqdhwifwvgpfigaalavliydfilaprssdl
tdrvkvwts
SCOP Domain Coordinates for d1j4na_:
Click to download the PDB-style file with coordinates for d1j4na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j4na_:
- d1j4na_ is new in SCOP 1.61
- d1j4na_ appears in SCOP 1.63
- d1j4na_ appears in the current release, SCOPe 2.08
View in 3D